LL37

Price range: $57.00 through $77.00

SKU: N/A Category:

Description

LL-37 (Cathelicidin Antimicrobial Peptide / Innate Immune Modulator)

Molecular Formula: C₁₉₉H₃₄₅N₆₁O₆₁
Molecular Weight: 4,492.3 g/mol
Sequence: [LL-37, 37 aa]
CAS Number: 231533-57-8
Purity: ≥98 % (HPLC)
Form: Lyophilized Powder
Storage: Store at −20 °C. Protect from light and moisture.


Description

LL-37 is a 37-amino-acid cationic host-defense peptide derived from the human cathelicidin precursor hCAP-18.
It plays a central role in innate immunity, exhibiting broad-spectrum antimicrobial, antibiofilm, and immunomodulatory activity.

Research shows LL-37 interacts with bacterial membranes to induce membrane permeabilization, while also regulating cytokine expression, wound repair, and epithelial barrier integrity.
Beyond antimicrobial defense, it has become a key model for studying peptide-based immunity, inflammation modulation, and tissue regeneration.

Because of its dual antimicrobial and immunoregulatory functions, LL-37 serves as an important tool for exploring host–pathogen interactions, peptide therapeutics, and epithelial healing responses.


Intended Use

This product is intended for laboratory research use only.
It is not for human consumption, diagnostic, or therapeutic applications.
All handling should be performed by qualified professionals in a controlled research environment.


Key Research Applications

  • Investigation of antimicrobial peptide structure and membrane disruption mechanisms

  • Studies on innate immune signaling, cytokine modulation, and inflammation control

  • Research on epithelial regeneration and barrier repair

  • Analysis of host–pathogen interactions and peptide-based immune defense

Additional information

Dosage

5mg

Container

Vial, Pen Cartridge

Reviews

There are no reviews yet.

Be the first to review “LL37”

Your email address will not be published. Required fields are marked *